99%+ Purity
Guaranteed per batch
4.9 847 verified reviews
LL-37 · 5mg
Total Price
$499.95
Discounted Price
$349.96
Vials
5 vials
You Save
$149.99
30% OFF
On Sale!
Retail Price
$597.54
Your Price
$597.54
Per vial: $42.58
You Save
$597.54
33% OFF
Select Strength (mg)
99% HPLC Purity
Select Vials
Bulk pricing applied
📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 free vials.
Select Purchase Option:
-
99%+ HPLC Purity — Independently verified by accredited US laboratory -
Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
-
GMP-Certified Manufacturing — USA facility, ISO 9001:2015
-
Lyophilized for Stability — Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP
4.9 847 verified reviews
LL-37 · 5mg
Total Price
$499.95
Discounted Price
$349.96
Vials
5 vials
You Save
$149.99
30% OFF
Select Strength (mg)
99% HPLC Purity
Select Vials
Bulk pricing applied
📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 free vials.
Select Purchase Option:
-
99%+ HPLC Purity —
Independently verified by accredited US laboratory
-
Endotoxin-Screened —
LAL tested, LPS-free, endotoxin report available
-
GMP-Certified Manufacturing —
USA facility, ISO 9001:2015
-
Lyophilized for Stability —
Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP
LL-37 is a 37-amino-acid antimicrobial peptide derived from the human cathelicidin precursor hCAP18. As a research peptide, it is studied for its potential roles in antimicrobial activity, immune signaling, inflammation, cell migration, and tissue repair.
Its positively charged, amphipathic structure allows it to interact with biological membranes and cellular components, making it a useful subject for research in microbiology, immunology, cell biology, and peptide science. LL-37 remains an experimental research compound, and laboratory findings do not establish clinical use or safety.
LL-37 at a glance
| Sequence | [LL-37, 37 aa] |
|---|---|
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493 g/mol |
| Length | 37 amino acids |
| Application | Research use only |
What is LL-37?
LL-37 is a synthetic research peptide based on the naturally occurring human cathelicidin peptide involved in innate immune defense. The mature LL-37 sequence contains 37 amino acids and is derived from the human CAMP gene product. Because of its broad biological activity, LL-37 is frequently investigated as a model peptide in laboratory studies involving antimicrobial activity, immune signaling, inflammation, and cellular responses.
As a research peptide, LL-37 is commonly examined for its interactions with microbial membranes, immune cells, and signaling pathways. Researchers have also investigated its potential involvement in processes such as cell migration, tissue repair, angiogenesis, and inflammatory regulation. Its amphipathic, positively charged structure is considered an important factor underlying many of these biological interactions.
LL-37 research is conducted across several fields, including microbiology, immunology, peptide chemistry, cell biology, and regenerative biology. Experimental studies may use LL-37 to investigate peptide–membrane interactions, host-defense mechanisms, cellular signaling, or biological responses under controlled laboratory conditions.
Importantly, LL-37 sold or supplied for research purposes should be described as an experimental laboratory material rather than an approved therapeutic product. Findings from laboratory or preclinical research do not establish safety, efficacy, dosing, or suitability for human or veterinary use.
Why is LL-37 studied?
It is studied because a single short sequence carries both direct membrane-disrupting activity and receptor-mediated signalling activity, so it serves as a model for host-defence peptide chemistry generally.5
How is LL-37 studied in the lab?
Laboratory work uses circular dichroism and NMR to follow helix formation in membrane-mimetic environments, minimum-inhibitory-concentration assays against bacterial cultures, and cell-based assays of the signalling arm.5
What has preclinical research reported?
Keshri AK, et al. (2025). “LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity.
International Journal of Antimicrobial Agents, 65(1), 107398.
This recent review discusses LL-37’s antimicrobial activity against bacteria, fungi and viruses, and its immunomodulatory activity, as reported in laboratory research.
Cathelicidin peptide activity
Kuroda and colleagues reported in Frontiers in Oncology on the activity of LL-37 and of designed mimics in cell-based assays.5
Forms studied and handling
Supplied as a lyophilised powder. Store as stated in the specification box above, protected from light and moisture, and keep the vial sealed until use.
References
- Wang G. (2008). Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. The Journal of biological chemistry, 283(47), 32637–32643. https://doi.org/10.1074/jbc.M805533200. PMID 18818205
- Keshri, A. K., Rawat, S. S., Chaudhary, A., Sharma, S., Kapoor, A., Mehra, P., Kaur, R., Mishra, A., & Prasad, A. (2025). LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity. International journal of antimicrobial agents, 65(1), 107398. https://doi.org/10.1016/j.ijantimicag.2024.107398. PMID 39643165
- Oren, Z., Lerman, J. C., Gudmundsson, G. H., Agerberth, B., & Shai, Y. (1999). Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activity. The Biochemical journal, 341 ( Pt 3)(Pt 3), 501–513. PMID 10417311
- Porcelli, F., Verardi, R., Shi, L., Henzler-Wildman, K. A., Ramamoorthy, A., & Veglia, G. (2008). NMR structure of the cathelicidin-derived human antimicrobial peptide LL-37 in dodecylphosphocholine micelles. Biochemistry, 47(20), 5565–5572. https://doi.org/10.1021/bi702036s. PMID 18439024
- Kuroda K, Okumura K, Isogai H, Isogai E. The human cathelicidin antimicrobial peptide LL-37 and mimics are potential anticancer drugs. Front Oncol. 2015;5:144. doi:10.3389/fonc.2015.00144
For laboratory research use only. Products on this website are intended solely for in-vitro research. They are not medicines, have not been evaluated by the FDA, and are not intended to diagnose, treat, cure, or prevent any disease. Any administration to humans or animals is strictly prohibited.
What are these peptides made for?
Our peptides are produced exclusively for laboratory and scientific research purposes.
Licensed Peptides™ products are developed using industry-standard synthesis and purification protocols, making them suitable for in vitro research, analytical testing, and experimental models.
Research-grade standards
- Synthesized via Solid Phase Peptide Synthesis (SPPS)
- Purified using advanced HPLC methods
- Verified through analytical quality control processes
- Screened for heavy metals and endotoxins
Consistency across batches
Strict process controls ensure reproducibility, allowing researchers to work with confidence across experiments.
Applications
Our peptides are commonly used in research involving:
- Cellular signaling pathways
- Tissue remodeling and repair mechanisms
- Extracellular matrix regulation
- Molecular biology and biochemical studies
All products are intended for research use only and are not for human or animal consumption, therapeutic use, or clinical application.
Why buy from Licensed Peptides
At Licensed Peptides™, quality isn’t a claim — it’s a controlled, repeatable process.
Every peptide we produce follows a strict, pharma-grade workflow designed to ensure purity, stability, and consistency from synthesis to delivery.
What sets us apart
ISO-certified cleanroom manufacturing
All peptides are synthesized in sterile, controlled environments to eliminate contamination risk and ensure batch consistency.
>99% verified purity (HPLC tested)
We use advanced High-Performance Liquid Chromatography (HPLC) to separate and verify peptide purity with precision.
Comprehensive safety testing
Each batch undergoes heavy metal and endotoxin screening to ensure it is free from hidden contaminants.
Pharma-grade raw materials
We start with rigorously tested amino acids and reagents, ensuring integrity at the molecular level.
Lyophilized for stability
Freeze-dried peptides maintain long-term stability, potency, and reliability for research applications.
Nitrogen-sealed vials
Every vial is protected from oxygen and moisture, preserving structural integrity during storage and transit.
Built for serious research
From synthesis to delivery, every step is engineered to meet the expectations of professionals who require accuracy, consistency, and reliability.
For laboratory research use only. Not for human or veterinary use.
How orders ship
We understand that timing and product integrity are critical for research.
| Ships to | United States (including minor outlying islands) |
|---|---|
| Processing days | Monday to Friday, excluding holidays |
| Daily cut-off | Paid orders placed before 4:00 PM PST are typically shipped the same business day |
| Free shipping | FedEx 2-Day Express on orders over $200 and for VIP members |
| Standard | USPS Ground Advantage, 3–7 business days (not guaranteed) — $8.95 |
| Expedited | FedEx 2-Day $11.95 · UPS 2-Day $19.95 · FedEx Next Day $44.99 |
| Signature | Required on delivery for orders of $1,000 or more |
How orders are handled
Cold chain protection
Products are stored in industrial-grade freezers prior to shipment to maintain stability and purity.
Secure & protective packaging
Each order is carefully packed to protect against temperature fluctuations, moisture exposure, and physical damage during transit.
Tracking
Once your order has shipped you will receive a tracking number by email, so you can monitor delivery progress.
Shipped from the United States
Orders are dispatched domestically from a U.S.-based operation, so there are no international customs steps.
Delivery times
Shipping times are estimates and begin after order processing. Delays may occur due to carrier issues, weather, or other unforeseen factors, and delivery dates are not guaranteed. Full terms are in our Shipping & Delivery Policy.
For laboratory research use only. Not for human or veterinary use.
Storage conditions at a glance
| Lyophilized, in transit | Stable for shipping for up to 3–4 months |
|---|---|
| Lyophilized, short term | Room temperature is usually adequate for several weeks; refrigeration under 4°C (39°F) is generally acceptable |
| Lyophilized, long term | Freezer at -80°C (-112°F) for several months to years |
| After reconstitution | Refrigerated; stable for up to 30 days |
| Light and moisture | Keep cold and away from light in the original sealed vial |
Why the powder is stable
All of our products are manufactured using the lyophilization (freeze drying) process, which keeps them stable for shipping for up to 3–4 months.
Lyophilization is a unique dehydration process, also known as cryodesiccation, where the peptides are frozen and then subjected to low pressure. This causes the water in the peptide vial to sublimate directly from solid to gas, leaving behind a stable, crystalline white structure known as lyophilized peptide. The puffy white powder can be stored at room temperature until it is reconstituted with bacteriostatic water.
Storing vials on arrival
Once peptides have been received, it is imperative that they are kept cold and away from light. If the peptides will be used in the next several days, weeks or months, short-term refrigeration under 4°C (39°F) is generally acceptable. Lyophilized peptides are usually stable at room temperatures for several weeks or more, so if they will be utilized within weeks or months such storage is typically adequate.
For longer term storage (several months to years) it is more preferable to store peptides in a freezer at -80°C (-112°F). When storing peptides for months or even years, freezing is optimal in order to preserve the peptide’s stability.
After reconstitution
Once the peptides are reconstituted with bacteriostatic water, they must be stored in the fridge to maintain stability. After reconstitution, the peptides will remain stable for up to 30 days.
For laboratory research use only. Not for human or veterinary use.
99%+ Every Batch
Often Not Disclosed
