Fraud Blocker LL-37 5mg for Sale | 99%+ Purity, COA Included
2 for 1 sale NO LIMITS Your FREE unit is automatically added at checkout — no code needed. SHOP NOW Sale ends today

Need help? Call Or Text us, and a team member will be happy to assist you. +1 (855) 322-2214

Trustpilot rating badge

4.9 847 verified reviews

LL-37 · 5mg

Total Price $299.97
Discounted Price $248.97
Vials 3 vials
You Save
$51.00 17% OFF
Retail Price $597.54
Your Price $597.54 Per vial: $42.58
You Save $597.54 33% OFF
Select Strength (mg)
99% HPLC Purity
Select Vials
Bulk pricing applied
📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 free vials.
Select Purchase Option:
  • 99%+ HPLC Purity — Independently verified by accredited US laboratory
  • Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
  • GMP-Certified Manufacturing — USA facility, ISO 9001:2015
  • Lyophilized for Stability — Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP
Trustpilot rating badge

4.9 847 verified reviews

LL-37 · 5mg

Total Price $299.97
Discounted Price $248.97
Vials 3 vials
You Save
$51.00 17% OFF
⚠ Immune/Anti-Inflammatory Peptides ⚠ Popular Peptides
Select Strength (mg)
99% HPLC Purity
Select Vials
Bulk pricing applied
📈 Upgrade to 10 vials and save an extra vs. buying 5 — nearly 3 free vials.
Select Purchase Option:
  • 99%+ HPLC Purity — Independently verified by accredited US laboratory
  • Endotoxin-Screened — LAL tested, LPS-free, endotoxin report available
  • GMP-Certified Manufacturing — USA facility, ISO 9001:2015
  • Lyophilized for Stability — Shipped cold-packed, intact for reconstitution
Molecular Weight
Third Party Tested
APPLICATION
For Research Use only
Form
Lyophilized Powder
Storage
-20°C Long Term
Purity (HPLC)
99%+ Third Party Verified
Manufacture
USA / GMP

LL-37 is a 37-amino-acid antimicrobial peptide derived from the human cathelicidin precursor hCAP18. As a research peptide, it is studied for its potential roles in antimicrobial activity, immune signaling, inflammation, cell migration, and tissue repair.

Its positively charged, amphipathic structure allows it to interact with biological membranes and cellular components, making it a useful subject for research in microbiology, immunology, cell biology, and peptide science. LL-37 remains an experimental research compound, and laboratory findings do not establish clinical use or safety.

LL-37 at a glance

Sequence [LL-37, 37 aa]
Molecular formula C205H340N60O53
Molecular weight 4493 g/mol
Length 37 amino acids
Application Research use only

What is LL-37?

LL-37 is a synthetic research peptide based on the naturally occurring human cathelicidin peptide involved in innate immune defense. The mature LL-37 sequence contains 37 amino acids and is derived from the human CAMP gene product. Because of its broad biological activity, LL-37 is frequently investigated as a model peptide in laboratory studies involving antimicrobial activity, immune signaling, inflammation, and cellular responses.

As a research peptide, LL-37 is commonly examined for its interactions with microbial membranes, immune cells, and signaling pathways. Researchers have also investigated its potential involvement in processes such as cell migration, tissue repair, angiogenesis, and inflammatory regulation. Its amphipathic, positively charged structure is considered an important factor underlying many of these biological interactions.

LL-37 research is conducted across several fields, including microbiology, immunology, peptide chemistry, cell biology, and regenerative biology. Experimental studies may use LL-37 to investigate peptide–membrane interactions, host-defense mechanisms, cellular signaling, or biological responses under controlled laboratory conditions.

Importantly, LL-37 sold or supplied for research purposes should be described as an experimental laboratory material rather than an approved therapeutic product. Findings from laboratory or preclinical research do not establish safety, efficacy, dosing, or suitability for human or veterinary use.

Why is LL-37 studied?

It is studied because a single short sequence carries both direct membrane-disrupting activity and receptor-mediated signalling activity, so it serves as a model for host-defence peptide chemistry generally.5

How is LL-37 studied in the lab?

Laboratory work uses circular dichroism and NMR to follow helix formation in membrane-mimetic environments, minimum-inhibitory-concentration assays against bacterial cultures, and cell-based assays of the signalling arm.5

What has preclinical research reported?

Keshri AK, et al. (2025). “LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity.

International Journal of Antimicrobial Agents, 65(1), 107398.

This recent review discusses LL-37’s antimicrobial activity against bacteria, fungi and viruses, and its immunomodulatory activity, as reported in laboratory research.

Cathelicidin peptide activity

Kuroda and colleagues reported in Frontiers in Oncology on the activity of LL-37 and of designed mimics in cell-based assays.5

Screenshot 2026 08 27 at 12.45.09 AM

Forms studied and handling

Supplied as a lyophilised powder. Store as stated in the specification box above, protected from light and moisture, and keep the vial sealed until use.

References

  1. Wang G. (2008). Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. The Journal of biological chemistry, 283(47), 32637–32643. https://doi.org/10.1074/jbc.M805533200. PMID 18818205
  2. Keshri, A. K., Rawat, S. S., Chaudhary, A., Sharma, S., Kapoor, A., Mehra, P., Kaur, R., Mishra, A., & Prasad, A. (2025). LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity. International journal of antimicrobial agents, 65(1), 107398. https://doi.org/10.1016/j.ijantimicag.2024.107398. PMID 39643165
  3. Oren, Z., Lerman, J. C., Gudmundsson, G. H., Agerberth, B., & Shai, Y. (1999). Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activity. The Biochemical journal, 341 ( Pt 3)(Pt 3), 501–513. PMID 10417311
  4. Porcelli, F., Verardi, R., Shi, L., Henzler-Wildman, K. A., Ramamoorthy, A., & Veglia, G. (2008). NMR structure of the cathelicidin-derived human antimicrobial peptide LL-37 in dodecylphosphocholine micelles. Biochemistry, 47(20), 5565–5572. https://doi.org/10.1021/bi702036s. PMID 18439024
  5. Kuroda K, Okumura K, Isogai H, Isogai E. The human cathelicidin antimicrobial peptide LL-37 and mimics are potential anticancer drugs. Front Oncol. 2015;5:144. doi:10.3389/fonc.2015.00144

For laboratory research use only. Products on this website are intended solely for in-vitro research. They are not medicines, have not been evaluated by the FDA, and are not intended to diagnose, treat, cure, or prevent any disease. Any administration to humans or animals is strictly prohibited.

Licensed Peptides Process Document

What are these peptides made for?

Our peptides are produced exclusively for laboratory and scientific research purposes.

Licensed Peptides™ products are developed using industry-standard synthesis and purification protocols, making them suitable for in vitro research, analytical testing, and experimental models.

Research-grade standards

  • Synthesized via Solid Phase Peptide Synthesis (SPPS)
  • Purified using advanced HPLC methods
  • Verified through analytical quality control processes
  • Screened for heavy metals and endotoxins

Consistency across batches

Strict process controls ensure reproducibility, allowing researchers to work with confidence across experiments.

Applications

Our peptides are commonly used in research involving:

  • Cellular signaling pathways
  • Tissue remodeling and repair mechanisms
  • Extracellular matrix regulation
  • Molecular biology and biochemical studies

All products are intended for research use only and are not for human or animal consumption, therapeutic use, or clinical application.

Why buy from Licensed Peptides

At Licensed Peptides™, quality isn’t a claim — it’s a controlled, repeatable process.

Every peptide we produce follows a strict, pharma-grade workflow designed to ensure purity, stability, and consistency from synthesis to delivery.

What sets us apart

ISO-certified cleanroom manufacturing

All peptides are synthesized in sterile, controlled environments to eliminate contamination risk and ensure batch consistency.

>99% verified purity (HPLC tested)

We use advanced High-Performance Liquid Chromatography (HPLC) to separate and verify peptide purity with precision.

Comprehensive safety testing

Each batch undergoes heavy metal and endotoxin screening to ensure it is free from hidden contaminants.

Pharma-grade raw materials

We start with rigorously tested amino acids and reagents, ensuring integrity at the molecular level.

Lyophilized for stability

Freeze-dried peptides maintain long-term stability, potency, and reliability for research applications.

Nitrogen-sealed vials

Every vial is protected from oxygen and moisture, preserving structural integrity during storage and transit.

Built for serious research

From synthesis to delivery, every step is engineered to meet the expectations of professionals who require accuracy, consistency, and reliability.

For laboratory research use only. Not for human or veterinary use.

How orders ship

We understand that timing and product integrity are critical for research.

Ships to United States (including minor outlying islands)
Processing days Monday to Friday, excluding holidays
Daily cut-off Paid orders placed before 4:00 PM PST are typically shipped the same business day
Free shipping FedEx 2-Day Express on orders over $200 and for VIP members
Standard USPS Ground Advantage, 3–7 business days (not guaranteed) — $8.95
Expedited FedEx 2-Day $11.95 · UPS 2-Day $19.95 · FedEx Next Day $44.99
Signature Required on delivery for orders of $1,000 or more

How orders are handled

Cold chain protection

Products are stored in industrial-grade freezers prior to shipment to maintain stability and purity.

Secure & protective packaging

Each order is carefully packed to protect against temperature fluctuations, moisture exposure, and physical damage during transit.

Tracking

Once your order has shipped you will receive a tracking number by email, so you can monitor delivery progress.

Shipped from the United States

Orders are dispatched domestically from a U.S.-based operation, so there are no international customs steps.

Delivery times

Shipping times are estimates and begin after order processing. Delays may occur due to carrier issues, weather, or other unforeseen factors, and delivery dates are not guaranteed. Full terms are in our Shipping & Delivery Policy.

For laboratory research use only. Not for human or veterinary use.

Storage conditions at a glance

Lyophilized, in transit Stable for shipping for up to 3–4 months
Lyophilized, short term Room temperature is usually adequate for several weeks; refrigeration under 4°C (39°F) is generally acceptable
Lyophilized, long term Freezer at -80°C (-112°F) for several months to years
After reconstitution Refrigerated; stable for up to 30 days
Light and moisture Keep cold and away from light in the original sealed vial

Why the powder is stable

All of our products are manufactured using the lyophilization (freeze drying) process, which keeps them stable for shipping for up to 3–4 months.

Lyophilization is a unique dehydration process, also known as cryodesiccation, where the peptides are frozen and then subjected to low pressure. This causes the water in the peptide vial to sublimate directly from solid to gas, leaving behind a stable, crystalline white structure known as lyophilized peptide. The puffy white powder can be stored at room temperature until it is reconstituted with bacteriostatic water.

Storing vials on arrival

Once peptides have been received, it is imperative that they are kept cold and away from light. If the peptides will be used in the next several days, weeks or months, short-term refrigeration under 4°C (39°F) is generally acceptable. Lyophilized peptides are usually stable at room temperatures for several weeks or more, so if they will be utilized within weeks or months such storage is typically adequate.

For longer term storage (several months to years) it is more preferable to store peptides in a freezer at -80°C (-112°F). When storing peptides for months or even years, freezing is optimal in order to preserve the peptide’s stability.

After reconstitution

Once the peptides are reconstituted with bacteriostatic water, they must be stored in the fridge to maintain stability. After reconstitution, the peptides will remain stable for up to 30 days.

For laboratory research use only. Not for human or veterinary use.

LL-37 is a 37-amino-acid antimicrobial peptide derived from the human cathelicidin precursor hCAP18. As a research peptide, it is studied for its potential roles in antimicrobial activity, immune signaling, inflammation, cell migration, and tissue repair.

Its positively charged, amphipathic structure allows it to interact with biological membranes and cellular components, making it a useful subject for research in microbiology, immunology, cell biology, and peptide science. LL-37 remains an experimental research compound, and laboratory findings do not establish clinical use or safety.

LL-37 at a glance

Sequence [LL-37, 37 aa]
Molecular formula C205H340N60O53
Molecular weight 4493 g/mol
Length 37 amino acids
Application Research use only

What is LL-37?

LL-37 is a synthetic research peptide based on the naturally occurring human cathelicidin peptide involved in innate immune defense. The mature LL-37 sequence contains 37 amino acids and is derived from the human CAMP gene product. Because of its broad biological activity, LL-37 is frequently investigated as a model peptide in laboratory studies involving antimicrobial activity, immune signaling, inflammation, and cellular responses.

As a research peptide, LL-37 is commonly examined for its interactions with microbial membranes, immune cells, and signaling pathways. Researchers have also investigated its potential involvement in processes such as cell migration, tissue repair, angiogenesis, and inflammatory regulation. Its amphipathic, positively charged structure is considered an important factor underlying many of these biological interactions.

LL-37 research is conducted across several fields, including microbiology, immunology, peptide chemistry, cell biology, and regenerative biology. Experimental studies may use LL-37 to investigate peptide–membrane interactions, host-defense mechanisms, cellular signaling, or biological responses under controlled laboratory conditions.

Importantly, LL-37 sold or supplied for research purposes should be described as an experimental laboratory material rather than an approved therapeutic product. Findings from laboratory or preclinical research do not establish safety, efficacy, dosing, or suitability for human or veterinary use.

Why is LL-37 studied?

It is studied because a single short sequence carries both direct membrane-disrupting activity and receptor-mediated signalling activity, so it serves as a model for host-defence peptide chemistry generally.5

How is LL-37 studied in the lab?

Laboratory work uses circular dichroism and NMR to follow helix formation in membrane-mimetic environments, minimum-inhibitory-concentration assays against bacterial cultures, and cell-based assays of the signalling arm.5

What has preclinical research reported?

Keshri AK, et al. (2025). “LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity.

International Journal of Antimicrobial Agents, 65(1), 107398.

This recent review discusses LL-37’s antimicrobial activity against bacteria, fungi and viruses, and its immunomodulatory activity, as reported in laboratory research.

Cathelicidin peptide activity

Kuroda and colleagues reported in Frontiers in Oncology on the activity of LL-37 and of designed mimics in cell-based assays.5

Screenshot 2026 08 27 at 12.45.09 AM

Forms studied and handling

Supplied as a lyophilised powder. Store as stated in the specification box above, protected from light and moisture, and keep the vial sealed until use.

References

  1. Wang G. (2008). Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. The Journal of biological chemistry, 283(47), 32637–32643. https://doi.org/10.1074/jbc.M805533200. PMID 18818205
  2. Keshri, A. K., Rawat, S. S., Chaudhary, A., Sharma, S., Kapoor, A., Mehra, P., Kaur, R., Mishra, A., & Prasad, A. (2025). LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity. International journal of antimicrobial agents, 65(1), 107398. https://doi.org/10.1016/j.ijantimicag.2024.107398. PMID 39643165
  3. Oren, Z., Lerman, J. C., Gudmundsson, G. H., Agerberth, B., & Shai, Y. (1999). Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activity. The Biochemical journal, 341 ( Pt 3)(Pt 3), 501–513. PMID 10417311
  4. Porcelli, F., Verardi, R., Shi, L., Henzler-Wildman, K. A., Ramamoorthy, A., & Veglia, G. (2008). NMR structure of the cathelicidin-derived human antimicrobial peptide LL-37 in dodecylphosphocholine micelles. Biochemistry, 47(20), 5565–5572. https://doi.org/10.1021/bi702036s. PMID 18439024
  5. Kuroda K, Okumura K, Isogai H, Isogai E. The human cathelicidin antimicrobial peptide LL-37 and mimics are potential anticancer drugs. Front Oncol. 2015;5:144. doi:10.3389/fonc.2015.00144

For laboratory research use only. Products on this website are intended solely for in-vitro research. They are not medicines, have not been evaluated by the FDA, and are not intended to diagnose, treat, cure, or prevent any disease. Any administration to humans or animals is strictly prohibited.

What are these peptides made for?

Our peptides are produced exclusively for laboratory and scientific research purposes.

Licensed Peptides™ products are developed using industry-standard synthesis and purification protocols, making them suitable for in vitro research, analytical testing, and experimental models.

Research-grade standards

  • Synthesized via Solid Phase Peptide Synthesis (SPPS)
  • Purified using advanced HPLC methods
  • Verified through analytical quality control processes
  • Screened for heavy metals and endotoxins

Consistency across batches

Strict process controls ensure reproducibility, allowing researchers to work with confidence across experiments.

Applications

Our peptides are commonly used in research involving:

  • Cellular signaling pathways
  • Tissue remodeling and repair mechanisms
  • Extracellular matrix regulation
  • Molecular biology and biochemical studies

All products are intended for research use only and are not for human or animal consumption, therapeutic use, or clinical application.

Why buy from Licensed Peptides

At Licensed Peptides™, quality isn’t a claim — it’s a controlled, repeatable process.

Every peptide we produce follows a strict, pharma-grade workflow designed to ensure purity, stability, and consistency from synthesis to delivery.

What sets us apart

ISO-certified cleanroom manufacturing

All peptides are synthesized in sterile, controlled environments to eliminate contamination risk and ensure batch consistency.

>99% verified purity (HPLC tested)

We use advanced High-Performance Liquid Chromatography (HPLC) to separate and verify peptide purity with precision.

Comprehensive safety testing

Each batch undergoes heavy metal and endotoxin screening to ensure it is free from hidden contaminants.

Pharma-grade raw materials

We start with rigorously tested amino acids and reagents, ensuring integrity at the molecular level.

Lyophilized for stability

Freeze-dried peptides maintain long-term stability, potency, and reliability for research applications.

Nitrogen-sealed vials

Every vial is protected from oxygen and moisture, preserving structural integrity during storage and transit.

Built for serious research

From synthesis to delivery, every step is engineered to meet the expectations of professionals who require accuracy, consistency, and reliability.

For laboratory research use only. Not for human or veterinary use.

How orders ship

We understand that timing and product integrity are critical for research.

Ships to United States (including minor outlying islands)
Processing days Monday to Friday, excluding holidays
Daily cut-off Paid orders placed before 4:00 PM PST are typically shipped the same business day
Free shipping FedEx 2-Day Express on orders over $200 and for VIP members
Standard USPS Ground Advantage, 3–7 business days (not guaranteed) — $8.95
Expedited FedEx 2-Day $11.95 · UPS 2-Day $19.95 · FedEx Next Day $44.99
Signature Required on delivery for orders of $1,000 or more

How orders are handled

Cold chain protection

Products are stored in industrial-grade freezers prior to shipment to maintain stability and purity.

Secure & protective packaging

Each order is carefully packed to protect against temperature fluctuations, moisture exposure, and physical damage during transit.

Tracking

Once your order has shipped you will receive a tracking number by email, so you can monitor delivery progress.

Shipped from the United States

Orders are dispatched domestically from a U.S.-based operation, so there are no international customs steps.

Delivery times

Shipping times are estimates and begin after order processing. Delays may occur due to carrier issues, weather, or other unforeseen factors, and delivery dates are not guaranteed. Full terms are in our Shipping & Delivery Policy.

For laboratory research use only. Not for human or veterinary use.

Storage conditions at a glance

Lyophilized, in transit Stable for shipping for up to 3–4 months
Lyophilized, short term Room temperature is usually adequate for several weeks; refrigeration under 4°C (39°F) is generally acceptable
Lyophilized, long term Freezer at -80°C (-112°F) for several months to years
After reconstitution Refrigerated; stable for up to 30 days
Light and moisture Keep cold and away from light in the original sealed vial

Why the powder is stable

All of our products are manufactured using the lyophilization (freeze drying) process, which keeps them stable for shipping for up to 3–4 months.

Lyophilization is a unique dehydration process, also known as cryodesiccation, where the peptides are frozen and then subjected to low pressure. This causes the water in the peptide vial to sublimate directly from solid to gas, leaving behind a stable, crystalline white structure known as lyophilized peptide. The puffy white powder can be stored at room temperature until it is reconstituted with bacteriostatic water.

Storing vials on arrival

Once peptides have been received, it is imperative that they are kept cold and away from light. If the peptides will be used in the next several days, weeks or months, short-term refrigeration under 4°C (39°F) is generally acceptable. Lyophilized peptides are usually stable at room temperatures for several weeks or more, so if they will be utilized within weeks or months such storage is typically adequate.

For longer term storage (several months to years) it is more preferable to store peptides in a freezer at -80°C (-112°F). When storing peptides for months or even years, freezing is optimal in order to preserve the peptide’s stability.

After reconstitution

Once the peptides are reconstituted with bacteriostatic water, they must be stored in the fridge to maintain stability. After reconstitution, the peptides will remain stable for up to 30 days.

For laboratory research use only. Not for human or veterinary use.

99%+ Purity
99%+ Purity

Guaranteed per batch

HPLC + Mass Spec
HPLC + Mass Spec

Independent lab verified

Endotoxin-Free
Endotoxin-Free

Vanguard Laboratory · ISO/IEC 17025

GMP-Certified
GMP-Certified

USA-manufactured

Same-Day Shipping
Same-Day Shipping

Free FedEx on $200+

Alert
Endotoxin Note: LL-37 5mg is endotoxin-screened at the compound level. Full LAL test results available in the product COA.
Vendor Comparison

Why Researchers Choose Licensed Peptides

Not all peptide vendors hold themselves to the same verification standards.

Verification Standard Licensed Peptides Generic Vendors
HPLC Purity Analysis ✓ 99%+ Every Batch ✗ Often Not Disclosed
Mass Spectrometry Identity ✓ Sequence Confirmed ✗ Rarely Available
Endotoxin Screening (LAL) ✓ Every Product ✗ Industry Exception
GMP-Certified USA Manufacture ✓ ISO 9001:2015 ✗ Often Overseas
COA Published & Downloadable ✓ Every Lot ✗ Inconsistent
Same-Day USA Fulfillment ✓ Before 4PM PST ✗ 3-10 Day Lead Time
Frequently Paired With

Researchers Also Order

Not all peptide vendors hold themselves to the same verification standards.

Order Today

Research-Grade
LL-37 5mg Ships Same Day

99.4% HPLC Verified · Endotoxin-Screened · GMP-Certified ·
Free FedEx 2-Day on $200+

View Full COA

You cannot copy content of this page